Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Sodium Potassium ATPase Alpha 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP237955
Description
Sodium Potassium ATPase Alpha 3 Polyclonal specifically detects Sodium Potassium ATPase Alpha 3 in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Sodium Potassium ATPase Alpha 3 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
P13637 | |
ATP1A3 | |
This antibody was developed against a recombinant protein corresponding to amino acids: EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
alpha 3 polypeptide, ATPase, Na+/K+ transporting, alpha 3 polypeptide, dystonia 12, DYT12, EC 3.6.3, MGC13276, RDP, Sodium pump subunit alpha-3, sodium/potassium-transporting ATPase alpha-3 chain, sodium/potassium-transporting ATPase subunit alpha-3 | |
Rabbit | |
Affinity Purified | |
RUO | |
478 | |
Human, Rat | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction