Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Solute carrier family 22 member 18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15974720UL
Description
Solute carrier family 22 member 18 Polyclonal specifically detects Solute carrier family 22 member 18 in Human samples. It is validated for Western Blot.Specifications
Solute carrier family 22 member 18 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
BWR1AORCTL2, BWSCR1Asolute carrier family 22 (organic cation transporter), member 1-like, Efflux transporter-like protein, HET, imprinted multi-membrane spanning polyspecific transporter-related protein 1, Imprinted multi-membrane-spanning polyspecific transporter-related protein 1, IMPT1DKFZp667A184, ITMp45-BWR1A, ORCTL-2, organic cation transporter-like 2, Organic cation transporter-like protein 2, p45 Beckwith-Wiedemann region 1A, SLC22A1Lcandidate A, solute carrier family 22 member 18, Solute carrier family 22 member 1-like, solute carrier family 22, member 18, TSSC5p45-Beckwith-Wiedemann region 1 A, Tumor-suppressing STF cDNA 5 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein | |
Rabbit | |
Affinity Purified | |
RUO | |
5002 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
SLC22A18 | |
Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG. | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction