Somatostatin R4/SSTR4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP23902225UL

Catalog No. NB436034

Description

Somatostatin R4/SSTR4 Polyclonal specifically detects Somatostatin R4/SSTR4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Somatostatin R4/SSTR4
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P31391
• Gene Symbols: SSTR4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YATALKSKGGAGCMCPPLPCQQEALQPEPGRKRIPLTRTTTF
• Quantity: 25 μL
• Research Discipline: Breast Cancer, Cell Cycle and Replication
• Gene ID (Entrez): 6754
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: G-protein coupled receptor, somatostatin receptor 4, somatostatin receptor type 4, SS4R, SS-4-R, SS4-R
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.