SORBS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309956100UL

Catalog No. NB124813

Description

SORBS1 Polyclonal specifically detects SORBS1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SORBS1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: c-Cbl associated protein, c-Cbl-associated protein, DKFZp451C066, DKFZp586P1422, Fas-ligand associated factor 2, FLAF2, KIAA0894, KIAA1296CAPSH3D5SH3P12FLJ12406, ponsin, R85FL, SH3 domain protein 5, SH3-domain protein 5 (ponsin), sh3p12, SORB1, sorbin and SH3 domain containing 1, sorbin and SH3 domain-containing protein 1
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SRBS1. Peptide sequence SEMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRA
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10580
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.