Invitrogen™ Sorcin Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595611

Catalog No. PIPA595611

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human U20S whole cell, human A431 whole cell, human PC-3 whole cell, human HL-60 whole cell, human K562 whole cell, human Caco-2 whole cell, rat lung tissue, mouse lung tissue. IHC: human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue. ICC/IF: U20S cell. Flow: SiHa cell, U20S cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Sorcin is a 198 amino acid, soluble, resistance-related, calcium-binding cytosolic protein belonging to the penta-EF hand (PEF) family of calcium binding proteins and contains 4 EF-hand calcium-binding motifs. Human Sorcin is known to share 95% sequence identity with hamster Sorcin. It is known to associate with the sarcolemmal proteins Annexin VII, cardiac ryanodine receptors and L-type Ca2+ channels and thus influence the intracellular Ca (2+)-homeostasis. It is also important in the regulation of intracellular Ca2+ cycling and Ca2+ influx pathways in the heart and skeletal muscle during excitation-contraction. It is overproduced in many multi-drug resistance (MDR) cells and regulates cell apoptosis pathways, thus acting as a new MDR marker for prognosis of acute myeloid leukemia (AML) and a good target for anti-MDR drug development.

Specifications

• Antigen: Sorcin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: Sri
• Gene Alias: 22 kDa protein; 2210417O06Rik; 2900070H08Rik; calcium binding protein amplified in mutlidrug-resistant cells; CP22; CP-22; H_RG167B05.1; SCN; Sor; Sorcin; SRI; V19
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 109552, 6717, 683667
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P30626, Q6P069
• Gene Symbols: Sri
• Immunogen: A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG