Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ SOX10 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580053
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580053 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580053 Supplier Invitrogen™ Supplier No. PA580053
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SH-SY5Y whole cell, human U251 whole cell, human U2OS whole cell, human U87 whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue, mouse Neuro-2a whole cellIHC: human melanoma tissue, mouse brain tissue.

SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SOX10
Applications Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene SOX10
Gene Accession No. O55170, P56693, Q04888
Gene Alias cls; cls/sox10; colorless; colourless; colourless/sox10; DOM; dominant megacolon; dominant megacolon, mouse, human homolog of; golas; gos; HMG-box transcription factor Sox10; MGC15649; PCWH; Protein SOX-21; SOX10; Sox-10; sox10 protein; sox10b; Sox21; SOX9; SRY; SRY (sex determining region Y)-box 10; SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal); SRY box 10; SRY-box 10; SRY-box containing gene 10; SRY-box containing protein 10; SRY-box transcription factor 10; SRY-related HMG-box gene 10; transcription factor SOX-10; Transcription factor SOX-M; WS2E; WS4; WS4C; zgc:100757
Gene Symbols SOX10
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human SOX10 (KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20665, 29361, 6663
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.