Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SOX3 Antibody (CL4725), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $610.00
Specifications
Antigen | SOX3 |
---|---|
Applications | Western Blot |
Classification | Monoclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
SOX3 Monoclonal specifically detects SOX3 in Human, Mouse samples. It is validated for Western Blot.Specifications
SOX3 | |
Monoclonal | |
Purified | |
RUO | |
GHDX, MRGH, panhypopituitarism, PHP, PHPX, SOXB, SRY (sex determining region Y)-box 3, transcription factor SOX-3 | |
SOX3 | |
IgG1 | |
Protein A purified |
Western Blot | |
Unconjugated | |
Mouse | |
Human, Mouse | |
6658 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGLFTVAAPAPGAPSPPATLAHLLPAPAMYSLLETELKNPVGTPTQAAGTGGPAAPGGAGKSSA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title