SP-D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158977

Catalog No. NBP158977

Description

SP-D Polyclonal specifically detects SP-D in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SP-D
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: COLEC7collectin-7, collectin 7, Collectin-7, Lung surfactant protein D, PSPD, PSP-D, SFTP4pulmonary surfactant-associated protein D, SP-Dpulmonary surfactant apoprotein, surfactant protein D, surfactant, pulmonary-associated protein D, surfactant-associated protein, pulmonary 4
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 6441
• Reconstitution: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P35247
• Gene Symbols: SFTPD
• Immunogen: Synthetic peptides corresponding to SFTPD(surfactant, pulmonary-associated protein D) The peptide sequence was selected from the middle region of SFTPD (NP_003010). Peptide sequence PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 85%.
• Target Species: Human, Mouse, Rat, Canine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only