SP140 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180009

Catalog No. NBP180009

Description

SP140 Polyclonal specifically detects SP140 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SP140
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Lymphoid-restricted homolog of Sp100, lymphoid-specific SP100 homolog, LYSP100, LYSP100-A, LYSP100-B, MGC126440, Nuclear autoantigen Sp-140, nuclear body protein SP140, SP140 nuclear body protein, Speckled 140 kDa
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_001005176
• Gene Symbols: SP140
• Immunogen: Synthetic peptide directed towards the N terminal of human SP140. Peptide sequence PEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNL.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11262
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine
• Form: Purified

For Research Use Only