Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580060

Invitrogen™ SP5 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580060
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580060 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580060 Supplier Invitrogen™ Supplier No. PA580060
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: MCF-7 whole cell. IHC: human placenta tissue.

SP5 binds to GC boxes promoters elements. SP5 probable transcriptional activator that has a role in the coordination of changes in transcription required to generate pattern in the developing embryo.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SP5
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene SP5
Gene Accession No. Q6BEB4
Gene Alias SP5; Sp5 transcription factor; trans-acting transcription factor 5; transcription factor Sp5
Gene Symbols SP5
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 389058
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.