Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPAG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23870725UL
Description
SPAG1 Polyclonal specifically detects SPAG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SPAG1 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Q07617 | |
SPAG1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDYEEAVMYYT | |
25 μL | |
Cancer, Developmental Biology | |
6674 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FLJ32920, HSD-3.8sperm-associated antigen 1, Infertility-related sperm protein Spag-1, SP75, sperm associated antigen 1, tetratricopeptide repeat-containing protein, TPIS, TPR-containing protein involved in spermatogenesis | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction