SPAG4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23893725UL

Catalog No. NB436054

Description

SPAG4 Polyclonal specifically detects SPAG4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SPAG4
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9NPE6
• Gene Symbols: SPAG4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSDITLQHPPPSVEHTGGANSAPRDFAVFGLQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGH
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: acrosomal protein ACR55, CT127, Outer dense fiber-associated protein SPAG4, Sad1 and UNC84 domain containing 4, sperm associated antigen 4, sperm tail protein, sperm-associated antigen 4 protein, SUN domain-containing protein 4, SUN4°Cancer/testis antigen 127
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6676
• Target Species: Human
• Isotype: IgG