Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SPATA12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SPATA12 Polyclonal specifically detects SPATA12 in Human samples. It is validated for Western Blot.Specifications
SPATA12 | |
Polyclonal | |
Rabbit | |
Human | |
spermatogenesis associated 12, spermatogenesis-associated protein 12, SRG5Spermatogenesis-related protein 5 | |
SPATA12 | |
IgG | |
20 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_859078 | |
353324 | |
Synthetic peptide directed towards the N terminal of human SPATA12The immunogen for this antibody is SPATA12. Peptide sequence MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title