Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA12 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SPATA12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179430
|
Novus Biologicals
NBP179430 |
100 μL |
Each of 1 for $436.00
|
|
Description
SPATA12 Polyclonal specifically detects SPATA12 in Human samples. It is validated for Western Blot.Specifications
SPATA12 | |
Polyclonal | |
Rabbit | |
Human | |
NP_859078 | |
353324 | |
Synthetic peptide directed towards the N terminal of human SPATA12The immunogen for this antibody is SPATA12. Peptide sequence MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
spermatogenesis associated 12, spermatogenesis-associated protein 12, SRG5Spermatogenesis-related protein 5 | |
SPATA12 | |
IgG | |
Affinity Purified | |
20 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title