Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | SPATA5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SPATA5 Polyclonal specifically detects SPATA5 in Human samples. It is validated for Western Blot.Specifications
| SPATA5 | |
| Polyclonal | |
| Rabbit | |
| Q8NB90 | |
| 166378 | |
| Synthetic peptides corresponding to SPATA5(spermatogenesis associated 5) The peptide sequence was selected from the middle region of SPATA5. Peptide sequence ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| AFG2ATPase family gene 2 homolog, ATPase family protein 2 homolog, SPAFspermatogenesis associated factor SPAF, spermatogenesis associated 5, Spermatogenesis-associated factor protein, spermatogenesis-associated protein 5 | |
| SPATA5 | |
| IgG | |
| 68 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title