Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATA9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SPATA9 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SPATA9 Polyclonal specifically detects SPATA9 in Human samples. It is validated for Western Blot.Specifications
SPATA9 | |
Polyclonal | |
Rabbit | |
Q9BWV2 | |
83890 | |
Synthetic peptides corresponding to SPATA9(spermatogenesis associated 9) The peptide sequence was selected from the N terminal of SPATA9. Peptide sequence PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ35906, NYD-SP16, spermatogenesis associated 9, spermatogenesis-associated protein 9, Testis development protein NYD-SP16 | |
SPATA9 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title