Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPATC1L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310592100UL
Description
SPATC1L Polyclonal specifically detects SPATC1L in Human samples. It is validated for Western Blot.Specifications
| SPATC1L | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| chromosome 21 open reading frame 56, DKFZp434N0650, MGC99490 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human SPATC1L (NP_115637). Peptide sequence MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLD | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 84221 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction