Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Speedy/Ringo Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Speedy/Ringo |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Speedy/Ringo Polyclonal specifically detects Speedy/Ringo in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Speedy/Ringo | |
Polyclonal | |
Rabbit | |
Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
245711 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
hSpy/Ringo A, MGC110856, Rapid inducer of G2/M progression in oocytes A, RINGO A, Ringo3, SPDY1, speedy homolog 1 (Drosophila), speedy homolog A (Xenopus laevis), speedy protein A, speedy-1, Spy1, SPY1MGC57218 | |
SPDYA | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title