Sperm-associated antigen 7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP19026125UL

Catalog No. NB430441

Description

Sperm-associated antigen 7 Polyclonal specifically detects Sperm-associated antigen 7 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Sperm-associated antigen 7
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: ACRP, FSA-1, MGC20134, sperm associated antigen 7, sperm-associated antigen 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9552
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SPAG7
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only