Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPO11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158172 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158172 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158172 Supplier Novus Biologicals Supplier No. NBP158172
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SPO11 Polyclonal specifically detects SPO11 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen SPO11
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y5K1
Gene Alias Cancer/testis antigen 35, CT35MGC39953, meiotic recombination protein SPO11, SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae), SPO11 meiotic protein covalently bound to DSB-like (S. cerevisiae), SPO11, meiotic protein covalently bound to DSB (S. cerevisiae)-like
Gene Symbols SPO11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SPO11(SPO11 meiotic protein covalently bound to DSB homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SPO11. Peptide sequence KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA Repair, Editing and Processing Endonucleases
Primary or Secondary Primary
Gene ID (Entrez) 23626
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Chicken: 84%; Zebrafish: 76%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.