SPSB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23056925UL

Catalog No. NB437524

Description

SPSB2 Polyclonal specifically detects SPSB2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SPSB2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q99619
• Gene Symbols: SPSB2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
• Quantity: 25ul
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 84727
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ17395, Gene-rich cluster protein C9, GRCC9MGC2519, splA/ryanodine receptor domain and SOCS box containing 2, SPRY domain-containing SOCS box protein SSB-2, SSB-2, SSB2SPRY domain-containing SOCS box protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only