Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPTLC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | SPTLC1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SPTLC1 Polyclonal specifically detects SPTLC1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SPTLC1 | |
Polyclonal | |
Rabbit | |
O15269 | |
10558 | |
Synthetic peptides corresponding to SPTLC1(serine palmitoyltransferase, long chain base subunit 1) The peptide sequence was selected from the middle region of SPTLC1. Peptide sequence ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
EC 2.3.1.50, hereditary sensory neuropathy, type 1, HSAN1, LBC1, LCB 1, LCB1HSAN, Long chain base biosynthesis protein 1, MGC14645, serine C-palmitoyltransferase, serine palmitoyltransferase 1, serine palmitoyltransferase, long chain base subunit 1, Serine-palmitoyl-CoA transferase 1, SPT 1, SPT1HSN1, SPTI | |
SPTLC1 | |
IgG | |
53 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title