Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Src Antibody, Novus Biologicals™
SDP

Catalog No. NB436294 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436294 25 μL
NBP238165 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436294 Supplier Novus Biologicals Supplier No. NBP23816525UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Src Polyclonal specifically detects Src in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Src
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P12931
Gene Alias c-src, EC 2.7.10, EC 2.7.10.2, pp60c-src, Rous sarcoma, tyrosine kinase pp60c-src, tyrosine-protein kinase SRC-1, v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog, v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)
Gene Symbols SRC
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer Stem Cells, Protein Kinase, Signal Transduction, Transcription Factors and Regulators, Tyrosine Kinases
Primary or Secondary Primary
Gene ID (Entrez) 6714
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.