Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SRC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | SRC1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SRC1 Polyclonal specifically detects SRC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SRC1 | |
Polyclonal | |
Rabbit | |
Cancer, Chromatin Research, Transcription Factors and Regulators | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
8648 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAINQSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETEL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
bHLHe42, BHLHE74, Class E basic helix-loop-helix protein 74, EC 2.3.1.48, Hin-2 protein, KAT13A, MGC129719, NCoA-1, nuclear receptor coactivator 1, PAX3/NCOA1 fusion protein, Protein Hin-2, Renal carcinoma antigen NY-REN-52, RIP160bHLHe74F-SRC-1, SRC-1, SRC1MGC129720, Steroid receptor coactivator 1, steroid receptor coactivator-1 | |
NCOA1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title