Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SRCRB4D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP237994
Description
SRCRB4D Polyclonal specifically detects SRCRB4D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SRCRB4D | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Q8WTU2 | |
SSC4D | |
This antibody was developed against a recombinant protein corresponding to amino acids: PGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQP | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
S4D-SRCRB, S4-SRCRB, scavenger receptor cysteine rich domain containing, group B (4 domains), scavenger receptor cysteine-rich domain-containing group B protein, scavenger receptor cysteine-rich protein SRCRB-S4D, SRCRB-S4D, SSC4D | |
Rabbit | |
Affinity Purified | |
RUO | |
136853 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction