Learn More
SRD5A2 Rabbit anti-Human, Mouse, Rat, Clone: 8A4H5, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | SRD5A2 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 8A4H5 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | 3-oxo-5-alpha-steroid 4-dehydrogenase 2,5 alpha-SR2, EC 1.3.99.5, MGC138457, S5AR 2, SR type 2, Steroid 5-alpha-reductase 2,3-oxo-5 alpha-steroid 4-dehydrogenase 2, steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 2), Type II 5-alpha reductase |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRD5A2 (P31213). MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSL |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.