Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SRGAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SRGAP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SRGAP1 Polyclonal specifically detects SRGAP1 in Mouse samples. It is validated for Western Blot.Specifications
SRGAP1 | |
Polyclonal | |
Rabbit | |
AAL27030 | |
57522 | |
Synthetic peptide directed towards the middle region of human Srgap1The immunogen for this antibody is Srgap1. Peptide sequence DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ARHGAP13srGAP1, FLJ22166, KIAA1304SLIT-ROBO Rho GTPase-activating protein 1, Rho GTPase-activating protein 13, SLIT-ROBO Rho GTPase activating protein 1 | |
SRGAP1 | |
IgG | |
80 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title