Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    SRGAP3 Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP188831
Description
SRGAP3 Polyclonal specifically detects SRGAP3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SRGAP3 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| SLIT-ROBO Rho GTPase activating protein 2, SLIT-ROBO Rho GTPase activating protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9901 | |
| Human, Rat | |
| IgG | 
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SRGAP3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LKNPPGPVSSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRS | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            For Research Use Only
Spot an opportunity for improvement?Share a Content Correction