SRP14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157413

Catalog No. NBP157413

Description

SRP14 Polyclonal specifically detects SRP14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SRP14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ALURBP, MGC14326,18 kDa Alu RNA-binding protein, signal recognition particle 14 kDa protein, signal recognition particle 14kD (homologous Alu RNA-binding protein), signal recognition particle 14kDa (homologous Alu RNA binding protein)
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6727
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P37108
• Gene Symbols: SRP14
• Immunogen: Synthetic peptides corresponding to SRP14 (signal recognition particle 14kDa (homologous Alu RNA binding protein)) The peptide sequence was selected from the N terminal of SRP14. Peptide sequence KPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLL The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 92%; Rat: 92%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Form: Purified

For Research Use Only