SRp55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157112

Catalog No. NBP157112

Description

SRp55 Polyclonal specifically detects SRp55 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SRp55
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B52, FLJ08061, pre-mRNA splicing factor SRP55, Pre-mRNA-splicing factor SRP55, serine/arginine-rich splicing factor 6, SFRS6, Splicing factor, arginine/serine-rich 6MGC5045, splicing factor, arginine/serine-rich, 55 kDa, SR splicing factor 6, SRP55arginine/serine-rich splicing factor 6
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6431
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q13247
• Gene Symbols: SRSF6
• Immunogen: Synthetic peptides corresponding to SFRS6(splicing factor, arginine/serine-rich 6) The peptide sequence was selected from the middle region of SFRS6. Peptide sequence KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only