Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. NBP231389PE

Novus Biologicals™ SRRM4 Protein
SDP

Catalog No. NBP231389PE Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP231389PE 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP231389PE Supplier Novus Biologicals™ Supplier No. NBP231389PEP

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Human Recombinant Protein

  • Amino Acid Sequence: ASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATEPLGTNSWERDKTCRELG
  • Source: E.Coli

This is a blocking peptide for NBP2-31389. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Gene ID (Entrez) 84530
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol SRRM4
Label Type Unlabeled
Molecular Weight (g/mol) 27kDa
Product Type SRRM4
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Immunogen ASVQQGEKQLFEKFWRGTFKAVATPRPESIIVASITARKPLPRTEPQNNPVVPAQDGPSEKLGQHLATEPLGTNSWERDKTCRELG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.