SSSCA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26882025UL

Catalog No. NB392879

Description

SSSCA1 Polyclonal antibody specifically detects SSSCA1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SSSCA1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Autoantigen p27, centromeric autoantigen (27kD), p27, Sjoegren syndrome/scleroderma autoantigen 1, Sjogren syndrome/scleroderma autoantigen 1, Sjogren's syndrome/scleroderma autoantigen 1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 10534
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified