Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SSX2IP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SSX2IP |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159113
|
Novus Biologicals
NBP159113 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SSX2IP Polyclonal specifically detects SSX2IP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SSX2IP | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ADIP, afadin- and alpha-actinin-binding protein, Afadin DIL domain-interacting protein, FLJ10848, KIAA0923, MGC75026, SSX2-interacting protein, synovial sarcoma, X breakpoint 2 interacting protein | |
| SSX2IP | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Q9Y2D8 | |
| 117178 | |
| Synthetic peptides corresponding to SSX2IP(synovial sarcoma, X breakpoint 2 interacting protein) The peptide sequence was selected from the middle region of SSX2IP. Peptide sequence KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title