Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SSX2IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SSX2IP |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SSX2IP Polyclonal specifically detects SSX2IP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SSX2IP | |
Polyclonal | |
Rabbit | |
Q9Y2D8 | |
117178 | |
Synthetic peptides corresponding to SSX2IP(synovial sarcoma, X breakpoint 2 interacting protein) The peptide sequence was selected from the middle region of SSX2IP. Peptide sequence KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
ADIP, afadin- and alpha-actinin-binding protein, Afadin DIL domain-interacting protein, FLJ10848, KIAA0923, MGC75026, SSX2-interacting protein, synovial sarcoma, X breakpoint 2 interacting protein | |
SSX2IP | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title