Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SSX2IP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SSX2IP
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159113
View Documents
Novus Biologicals
NBP159113
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

SSX2IP Polyclonal specifically detects SSX2IP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

SSX2IP
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
ADIP, afadin- and alpha-actinin-binding protein, Afadin DIL domain-interacting protein, FLJ10848, KIAA0923, MGC75026, SSX2-interacting protein, synovial sarcoma, X breakpoint 2 interacting protein
SSX2IP
IgG
Affinity Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
Q9Y2D8
117178
Synthetic peptides corresponding to SSX2IP(synovial sarcoma, X breakpoint 2 interacting protein) The peptide sequence was selected from the middle region of SSX2IP. Peptide sequence KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit