Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ST3GAL4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169565100UL
Description
ST3GAL4 Polyclonal specifically detects ST3GAL4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ST3GAL4 | |
Polyclonal | |
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q6IBE6 | |
ST3GAL4 | |
Synthetic peptides corresponding to ST3GAL4(ST3 beta-galactoside alpha-2,3-sialyltransferase 4) The peptide sequence was selected from the middle region of ST3GAL4. Peptide sequence FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV. | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% sodium azide | |
Alpha 2,3-sialyltransferase IV, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, CGS23FLJ46764, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.9, FLJ11867, gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, NANTA3alpha-3-N-acetylneuraminyltransferase, SAT3, SAT-3, Sialyltransferase 4C, sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase), SIAT4-C, SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, ST3 beta-galactoside alpha-2,3-sialyltransferase 4, ST3Gal IV, ST3GalA.2, ST3GalIV, ST-4, STZSIAT4 | |
Rabbit | |
100 μL | |
6484 | |
Store at -20°C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction