ST6 Sialyltransferase 6/ST6GALNAC6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325158

Catalog No. NB301294

Description

ST6 Sialyltransferase 6/ST6GALNAC6 Polyclonal antibody specifically detects ST6 Sialyltransferase 6/ST6GALNAC6 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: ST6 Sialyltransferase 6/ST6GALNAC6
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase VI, hST6GalNAc VI, RP11-203J24.3, Sialyltransferase 7F, sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F, SIAT7F, SIAT7-F, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6, ST6GalNAc VI, ST6GalNAcVI
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ST6 Sialyltransferase 6/ST6GALNAC6 using the following amino acid sequence: SSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLP
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 30815
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG