Learn More
Description
Specifications
Specifications
| Antigen | ST6 Sialyltransferase 6/ST6GALNAC6 |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase VI, hST6GalNAc VI, RP11-203J24.3, Sialyltransferase 7F, sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F, SIAT7F, SIAT7-F, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6, ST6GalNAc VI, ST6GalNAcVI |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein ST6 Sialyltransferase 6/ST6GALNAC6 using the following amino acid sequence: SSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLP |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
