Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ST6GALNAC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169326
Description
ST6GALNAC3 Polyclonal specifically detects ST6GALNAC3 in Human samples. It is validated for Western Blot.Specifications
ST6GALNAC3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III, EC 2.4.99.-, EC 2.4.99.7, FLJ13669, FLJ27239, GalNAc alpha-2,6-sialyltransferase III, PRO7177, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C, Sialyltransferase 7C, SIAT7C, SIAT7-C, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3, ST6GalNAc III, ST6GALNACIII, STY | |
Rabbit | |
35 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8NDV1 | |
ST6GALNAC3 | |
Synthetic peptides corresponding to ST6GALNAC3(ST6-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3) The peptide sequence was selected from the C terminal of ST6GALNAC3. Peptide sequence HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
256435 | |
Human, Mouse, Rat, Pig, Canine, Equine, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction