Invitrogen™ ST7 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595405

Catalog No. PIPA595405

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human Jurkat whole cell, human PC-3 whole cell, rat brain tissue, rat heart tissue, mouse brain tissue, mouse heart tissue, mouse Neuro-2a whole cell. ICC/IF: A431 cell. Flow: 293T cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.

Specifications

• Antigen: ST7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: St7
• Gene Alias: 4low density lipoprotein-related protein 12; 9430001H04Rik; ETS7q; FAM4A; FAM4A1; Fam4a2; family with sequence similarity 4, subfamily A, member 1; family with sequence similarity 4, subfamily A, member 2; HELG; mRay; Protein FAM4A1; Protein HELG; RAY1; SEN4; St7; suppression of tumorigenicity 7; suppression of tumorigenicity 7 (breast); suppressor of tumorigenicity 7 protein; TSG7
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 296911, 64213, 7982
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: Q2IBD0, Q99M96, Q9NRC1
• Gene Symbols: St7
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov