Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA595405

Invitrogen™ ST7 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595405
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595405 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595405 Supplier Invitrogen™ Supplier No. PA595405
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human Jurkat whole cell, human PC-3 whole cell, rat brain tissue, rat heart tissue, mouse brain tissue, mouse heart tissue, mouse Neuro-2a whole cell. ICC/IF: A431 cell. Flow: 293T cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ST7
Applications Flow Cytometry, Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene St7
Gene Accession No. Q2IBD0, Q99M96, Q9NRC1
Gene Alias 4low density lipoprotein-related protein 12; 9430001H04Rik; ETS7q; FAM4A; FAM4A1; Fam4a2; family with sequence similarity 4, subfamily A, member 1; family with sequence similarity 4, subfamily A, member 2; HELG; mRay; Protein FAM4A1; Protein HELG; RAY1; SEN4; St7; suppression of tumorigenicity 7; suppression of tumorigenicity 7 (breast); suppressor of tumorigenicity 7 protein; TSG7
Gene Symbols St7
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 296911, 64213, 7982
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.