ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB124987	Novus Biologicals NBP310043100UL	100 μg

Description

ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Polyclonal specifically detects ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3
• Applications: Western Blot
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Stem Cell Markers
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 6489
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 1.0 ug/ml
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Alpha-2,8-sialyltransferase 8A, alpha-N-acetylneuraminide alpha-2,8-sialyltransferase, disialoganglioside (GD3) synthase, Ganglioside GD3 synthase, Ganglioside GT3 synthase, ganglioside-specific alpha-2,8-polysialyltransferase, GD3 synthase), GD3S, sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3synthase) A, Sialyltransferase 8A, sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, Sialytransferase St8Sia I, SIAT8A, SIAT8-A, SIAT8EC 2.4.99.8, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1, ST8SiaI
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 (NP_003025.1). Peptide sequence RKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQA
• Purification Method: Affinity purified