ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB436778	Novus Biologicals NBP23371925UL	25 μL
NBP233719	Novus Biologicals NBP233719	0.1 mL

Description

ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Polyclonal specifically detects ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q92186
• Gene ID (Entrez): 8128
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Neuroscience
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: alpha-2,8-sialyltransferase 8B, alpha-2,8-sialyltransferase 8B 1, EC 2.4.99, EC 2.4.99.-, HsT19690, MGC116854, MGC116857, sialyltransferase 8 (alpha-2, 8-sialytransferase) B, Sialyltransferase 8B, Sialyltransferase X, Sialytransferase St8Sia II, SIAT8B, SIAT8-B, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, ST8SIA-II, STXST8SiaII
• Gene Symbols: ST8SIA2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only