ST8SIA-VI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170716

Catalog No. NBP170716

Description

ST8SIA-VI Polyclonal specifically detects ST8SIA-VI in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ST8SIA-VI
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ST8SIA6
• Immunogen: Synthetic peptides corresponding to ST8SIA6(ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6) The peptide sequence was selected from the middle region of ST8SIA6. Peptide sequence LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 91%; Bovine: 85%; Equine: 85%; Pig: 85%; Chicken: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 8-sialyltransferase), alpha-2,8-sialyltransferase 8F, alpha-2,8-sialyltransferase 8F variant 2, SIA8F, sialytransferase St8Sia VI, SIAT8F, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6, ST8SiaVI, ST8SIA-VI
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 338596
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only