Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ST8SIA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ST8SIA3 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ST8SIA3 Polyclonal specifically detects ST8SIA3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ST8SIA3 | |
Polyclonal | |
Rabbit | |
Human | |
Alpha-2,8-sialyltransferase 8C, Alpha-2,8-sialyltransferase III, EC 2.4.99.-, sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase, Sialyltransferase 8C, sialyltransferase 8C (alpha2,3Galbeta1,4GlcNAcalpha 2,8-sialyltransferase), Sialytransferase St8Sia III, SIAT8-C, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 3SIAT8C, ST8SiaIII | |
ST8SIA3 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
51046 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WPFGFDPNTREDLPYHYYDKKGTKFTTKWQESHQLPAEFQLLYRMHGEGLTKLTLSHCA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title