STAM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18328825UL

Catalog No. NB433058

Description

STAM2 Polyclonal specifically detects STAM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: STAM2
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DKFZp564C047, HBP, Hrs-binding protein, HSE1 homolog, signal transducing adapter molecule 2, signal transducing adaptor molecule (SH3 domain and ITAM motif) 2, STAM-2, STAM2A, STAM2B, STAM-like protein containing SH3 and ITAM domains 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10254
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: STAM2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQMGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only