StAR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP186992

Catalog No. NBP186992

Description

StAR Polyclonal specifically detects StAR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: StAR
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: cholesterol trafficker, mitochondrial steroid acute regulatory protein, StAR, StARD1, STARD1StAR-related lipid transfer (START) domain containing 1, START domain containing 1, START domain-containing protein 1, steroid acute regulatory protein, steroidogenic acute regulator, steroidogenic acute regulatory protein, steroidogenic acute regulatory protein, mitochondrial
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: STAR
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGWLPKSIINQVLSQTQVDFAN
• Quantity: 0.1 mL
• Research Discipline: Cancer
• Gene ID (Entrez): 6770
• Target Species: Human
• Isotype: IgG

For Research Use Only