Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STARD8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	STARD8
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16909820 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP16909820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP169098 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP169098	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

STARD8 Polyclonal specifically detects STARD8 in Human samples. It is validated for Western Blot.

Specifications

Antigen	STARD8
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	9754
Immunogen	Synthetic peptides corresponding to STARD8 (StAR-related lipid transfer (START) domain containing 8) The peptide sequence was selected from the N terminal of STARD8. Peptide sequence KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ARHGAP38, Deleted in liver cancer 3 protein, DKFZp686H1668, DLC3DLC-3, KIAA0189stAR-related lipid transfer protein 8, StARD8, StAR-related lipid transfer (START) domain containing 8, START domain containing 8, START domain-containing protein 8, STARTGAP3, START-GAP3
Gene Symbols	STARD8
Isotype	IgG
Molecular Weight of Antigen	122 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

STARD8 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents