Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STARD8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | STARD8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16909820
|
Novus Biologicals
NBP16909820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169098
|
Novus Biologicals
NBP169098 |
100 μL |
Each for $487.50
|
|
|||||
Description
STARD8 Polyclonal specifically detects STARD8 in Human samples. It is validated for Western Blot.Specifications
| STARD8 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 9754 | |
| Synthetic peptides corresponding to STARD8 (StAR-related lipid transfer (START) domain containing 8) The peptide sequence was selected from the N terminal of STARD8. Peptide sequence KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ARHGAP38, Deleted in liver cancer 3 protein, DKFZp686H1668, DLC3DLC-3, KIAA0189stAR-related lipid transfer protein 8, StARD8, StAR-related lipid transfer (START) domain containing 8, START domain containing 8, START domain-containing protein 8, STARTGAP3, START-GAP3 | |
| STARD8 | |
| IgG | |
| 122 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title