Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STARD8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | STARD8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16909820
|
Novus Biologicals
NBP16909820UL |
20 μL |
Each for $152.22
|
|
NBP169098
|
Novus Biologicals
NBP169098 |
100 μL |
Each for $436.00
|
|
Description
STARD8 Polyclonal specifically detects STARD8 in Human samples. It is validated for Western Blot.Specifications
STARD8 | |
Polyclonal | |
Rabbit | |
Human | |
ARHGAP38, Deleted in liver cancer 3 protein, DKFZp686H1668, DLC3DLC-3, KIAA0189stAR-related lipid transfer protein 8, StARD8, StAR-related lipid transfer (START) domain containing 8, START domain containing 8, START domain-containing protein 8, STARTGAP3, START-GAP3 | |
STARD8 | |
IgG | |
Affinity Purified | |
122 kDa |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
9754 | |
Synthetic peptides corresponding to STARD8 (StAR-related lipid transfer (START) domain containing 8) The peptide sequence was selected from the N terminal of STARD8. Peptide sequence KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title