Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580077

Invitrogen™ Staufen Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580077
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580077 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580077 Supplier Invitrogen™ Supplier No. PA580077
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human K562 whole cell, human HepG2 whole cell, human CACO-2 whole cell, human SiHa whole cell, human U20S whole cell, rat PC-12 whole cell.

STAU1 is a member of a family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human STAU1 also contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. STAU1 has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER. STAU1 is also known to interact with influenza ribonucleoproteins NS1, NP, and PA and is required for efficient viral replication.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Staufen
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene Stau1
Gene Accession No. O95793
Gene Alias 5830401L18Rik; AW549911; C85792; Double-stranded RNA-binding protein Staufen homolog 1; PPP1R150; protein phosphatase 1, regulatory subunit 150; RP3-470L14.2; STAU; Stau1; staufen (RNA binding protein) homolog 1 (Drosophila); staufen double-stranded RNA binding protein 1; staufen RNA binding protein homolog 1; staufen, RNA binding protein, homolog 1
Gene Symbols Stau1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Staufen (532-568aa HGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGN).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6780, 84496
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.