Invitrogen™ STING Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595268

Catalog No. PIPA595268

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Thymus Tissue, Mouse Thymus Tissue. IHC: human lung cancer tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

STING is a 379 amino acid containing signaling protein that acts as an important component of innate immune signaling. This signaling protein is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. STING may have translocon function, the translocon possibly being able to influence the induction of type I interferons and is also involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II) thus facilitating the detection of intracellular viral RNA species as well as B-form DNA and mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Generally seen in endoplasmic reticulum membrane, cell membrane and mitochondrion outer membrane, it is ubiquitously expressed in most of tissues.

Specifications

• Antigen: STING
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: TMEM173
• Gene Alias: 2610307O08Rik; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; ERIS; hMITA; hSTING; hypothetical LOC533661; mediator of IRF3 activation; Mita; mitochondrial mediator of IRF3 activation; mitochondrial transmembrane protein 173; MMITA; Mpys; mSTING; NET23; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; poSTING; RGD1562552; rSTING; SAVI; Stimulator of interferon genes protein; stimulator of interferon response cGAMP interactor 1; STING; STING1; tm173; Tmem173; Transmembrane protein 173
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 340061
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q86WV6
• Gene Symbols: TMEM173
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG