STK38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158362

Catalog No. NBP158362

Description

STK38 Polyclonal specifically detects STK38 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: STK38
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.11, EC 2.7.11.1, Ndr Ser/Thr kinase-like protein, NDR1, NDR1 protein kinase, NDRnuclear Dbf2-related 1, Nuclear Dbf2-related kinase 1, serine threonine protein kinase, serine/threonine kinase 38, serine/threonine-protein kinase 38
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Zebrafish: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q15208
• Gene Symbols: STK38
• Immunogen: Synthetic peptides corresponding to STK38(serine/threonine kinase 38) The peptide sequence was selected from the C terminal of STK38. Peptide sequence IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 11329
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.