Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STK38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15836220UL
Description
STK38 Polyclonal specifically detects STK38 in Human samples. It is validated for Western Blot.Specifications
| STK38 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q15208 | |
| STK38 | |
| Synthetic peptides corresponding to STK38(serine/threonine kinase 38) The peptide sequence was selected from the C terminal of STK38. Peptide sequence IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD. | |
| 20 μL | |
| Protein Kinase | |
| 11329 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.7.11, EC 2.7.11.1, Ndr Ser/Thr kinase-like protein, NDR1, NDR1 protein kinase, NDRnuclear Dbf2-related 1, Nuclear Dbf2-related kinase 1, serine threonine protein kinase, serine/threonine kinase 38, serine/threonine-protein kinase 38 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction