Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STK38 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15836220UL
Description
STK38 Polyclonal specifically detects STK38 in Human samples. It is validated for Western Blot.Specifications
STK38 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q15208 | |
STK38 | |
Synthetic peptides corresponding to STK38(serine/threonine kinase 38) The peptide sequence was selected from the C terminal of STK38. Peptide sequence IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD. | |
20 μL | |
Protein Kinase | |
11329 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
EC 2.7.11, EC 2.7.11.1, Ndr Ser/Thr kinase-like protein, NDR1, NDR1 protein kinase, NDRnuclear Dbf2-related 1, Nuclear Dbf2-related kinase 1, serine threonine protein kinase, serine/threonine kinase 38, serine/threonine-protein kinase 38 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title