STK38L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP19245425UL

Catalog No. NB429532

Description

STK38L Polyclonal specifically detects STK38L in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: STK38L
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: EC 2.7.11, EC 2.7.11.1, KIAA0965nuclear Dbf2-related 2, NDR2 protein kinase, NDR2serine/threonine-protein kinase 38-like, Nuclear Dbf2-related kinase 2, serine/threonine kinase 38 like
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: STK38L
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL
• Quantity: 25 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 23012
• Target Species: Human
• Isotype: IgG

For Research Use Only