Stomatin-like protein 1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310175100UL

Catalog No. NB125251

Description

Stomatin-like protein 1 Polyclonal specifically detects Stomatin-like protein 1 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Stomatin-like protein 1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EPB72-like protein 1, FLJ36370, hUNC-24, Protein unc-24 homolog, SLP1, SLP-1stomatin-like 1, stomatin (EPB72)-like 1, stomatin-like protein 1, Stomatin-related protein, STORPstomatin (EBP72)-like 1, UNC24
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse Stomatin-like protein 1 (NP_081218.3). Peptide sequence LGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPEPGSVGPGADAPESWP
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Mouse
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9399
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.