Learn More
Stomatin-like protein 1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | Stomatin-like protein 1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | EPB72-like protein 1, FLJ36370, hUNC-24, Protein unc-24 homolog, SLP1, SLP-1stomatin-like 1, stomatin (EPB72)-like 1, stomatin-like protein 1, Stomatin-related protein, STORPstomatin (EBP72)-like 1, UNC24 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse Stomatin-like protein 1 (NP_081218.3). Peptide sequence LGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPEPGSVGPGADAPESWP |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.